// We made it! "eventActions" : [ "context" : "", "actions" : [ "selector" : "#kudosButtonV2_5", "event" : "QuickReply", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ } } else { LITHIUM.Dialog.options['772458770'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; $('li.close-on-click').on('click',resetMenu); "initiatorDataMatcher" : "data-lia-message-uid" { "actions" : [ "event" : "addMessageUserEmailSubscription", }, "event" : "MessagesWidgetEditCommentForm", ', 'ajax'); }, }, "entity" : "1264155", Achtung, es folgt eine Signatur: Wenn überhaupt, dann jammern wir auf einem extrem hohen Niveau. "eventActions" : [ function setWarning(pagerId) { } "action" : "rerender" "context" : "", return false; { Bist du sicher, dass du fortfahren möchtest? "componentId" : "kudos.widget.button", "quiltName" : "ForumMessage", ] { "forceSearchRequestParameterForBlurbBuilder" : "false", }, { "event" : "ProductAnswerComment", "action" : "rerender" "}); "context" : "envParam:quiltName", } { } "disableLabelLinks" : "false", "context" : "", "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1264958 .lia-rating-control-passive', '#form_8'); } } { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Vodafone Kündigung PDF Vorlage Speichere die Vodafone PDF Kündigungsvorlage und drucke schnell und einfach dein fertiges Kündigungsschreiben aus. }, ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); } function disableInput(pagerId) { "actions" : [ }, "actions" : [ Außerordentliche Kündigung eines DSL-Vertrags Unter Umständen können Sie Ihren DSL-Vertrag auch schon vor Ablauf der Mindestlaufzeit kündigen. { LITHIUM.Loader.runJsAttached(); return false; document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no warning"); "event" : "RevokeSolutionAction", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "context" : "envParam:selectedMessage", "event" : "deleteMessage", "event" : "MessagesWidgetEditAnswerForm", }, "context" : "", }, "event" : "MessagesWidgetEditAction", })(LITHIUM.jQuery); })(LITHIUM.jQuery); // Pull in global jQuery reference var msg = $(".message-uid-1265970"); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/230913/page/2","ajaxErrorEventName":"LITHIUM:ajaxError","token":"jEcW1_UhD9ueAAqCv2mLJvK1CYPjdCWjwznmq_bUyr4. "actions" : [ "actions" : [ document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "context" : "", { "actions" : [ "context" : "", "context" : "", } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); }); }); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1264751 .lia-rating-control-passive', '#form_6'); var key = e.keyCode; }); ] } } document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "event" : "MessagesWidgetEditAnswerForm", "displayStyle" : "horizontal", "event" : "ProductAnswerComment", "disableLabelLinks" : "false", ] "disableLabelLinks" : "false", "action" : "rerender" "actions" : [ LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1264214 .lia-rating-control-passive', '#form_2'); LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); { "actions" : [ }, }, } { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", { "actions" : [ "action" : "pulsate" { { "action" : "rerender" "action" : "rerender" ] "actions" : [ // enable redirect to login page when "logmein" is typed into the void =) ', 'ajax'); }, "eventActions" : [ ] { if ( Number(val) < 1 ) { { document.getElementById("custom_board_pagination_warning_div" + pagerId).setAttribute("class","custom_board_pagination_warning_div warning"); "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv/thread-id/100420","ajaxErrorEventName":"LITHIUM:ajaxError","token":"JVXxDQfpbHiZoJabp28gcfiSgS8GrHCHp11bbGboUok. "actions" : [ "initiatorBinding" : true, "context" : "envParam:quiltName,message", { "; } "action" : "rerender" "kudosLinksDisabled" : "false", }, "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1264838 .lia-rating-control-passive', '#form_7'); "message" : "1264267", } }, "message" : "1264152", "actions" : [ $('#node-menu li.active').children('ul').show(); }); "action" : "rerender" "action" : "rerender" "accessibility" : false, "actions" : [ "action" : "pulsate" } return; "action" : "rerender" ] "context" : "", "truncateBody" : "true", "event" : "MessagesWidgetAnswerForm", { "message" : "1264267", } ] LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } "revokeMode" : "true", { "useCountToKudo" : "false", "context" : "", }, ;(function($) { { } function setWarning(pagerId) { "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ } if (element.hasClass('active')) { watching = false; CookieManager.setCookie("khoros_custom_announcement_banner", topicIdCustomAnnouncement); "actions" : [ { Wichtig ist, dass Sie Ihren Provider zuvor auf die unberechtigte Sperrung schriftlich hinweisen und innerhalb einer Frist um vollständige Freigabe des Anschlusses bitten. "action" : "rerender" "useTruncatedSubject" : "true", "event" : "MessagesWidgetAnswerForm", }, "context" : "", }, ;(function($) { sessionStorage.setItem("is_scroll", option); } "actions" : [ }, ] "selector" : "#messageview_7", ] "event" : "editProductMessage", } "actions" : [ } ] "accessibility" : false, LITHIUM.AjaxSupport.fromLink('#kudoEntity_5', 'kudoEntity', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {}, 'QiDAGb5dYKxtxwn8MKDA4I2VBNb3EBlGHy8xC6v8F5Q. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" "useCountToKudo" : "false", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "; "useSubjectIcons" : "true", { o.innerHTML = ""; LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] } resetMenu(); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); ], { }, } Bist du sicher, dass du fortfahren möchtest? { "event" : "ProductAnswer", "disableLabelLinks" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'd3tMbYHdm0NbWZilr76lmNVMUKMzF5PgxDBZobyQoVk. "truncateBodyRetainsHtml" : "false", { { } ] "event" : "kudoEntity", } "context" : "", } }, "event" : "removeMessageUserEmailSubscription", "event" : "MessagesWidgetEditAction", }, "action" : "rerender" ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1264958,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.Auth.CHECK_SESSION_TOKEN = 'brAMJayXYJZgseNXvTLqL4Z5bVfJUc01BV91e0l_w68. ] "parameters" : { "actions" : [ } }, { { "context" : "", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ "event" : "ProductAnswerComment", LITHIUM.AjaxSupport.ComponentEvents.set({ ] { LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); "event" : "ProductMessageEdit", "event" : "deleteMessage", }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] ] { "event" : "ProductAnswerComment", "showCountOnly" : "false", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); "event" : "MessagesWidgetAnswerForm", '; { "context" : "", "action" : "pulsate" }, // Reset the conditions so that someone can do it all again. { "selector" : "#kudosButtonV2_8", "parameters" : { }, "parameters" : { "truncateBody" : "true", "initiatorDataMatcher" : "data-lia-message-uid" "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_47","feedbackSelector":".InfoMessage"}); "displayStyle" : "horizontal", "event" : "ProductAnswerComment", } "actions" : [ "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); "action" : "rerender" "event" : "MessagesWidgetEditAction", { } } "selector" : "#messageview_8", "event" : "MessagesWidgetEditAction", "event" : "AcceptSolutionAction", "event" : "ProductAnswerComment", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", { "action" : "rerender" "action" : "rerender" { ;(function($) { count = 0; }, LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "actions" : [ "actions" : [ ] ;(function($) { { { { "event" : "MessagesWidgetCommentForm", { "useSimpleView" : "false", "context" : "", }, //$(window).scroll(function() { "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1264214 .lia-rating-control-passive', '#form_2'); ] "action" : "rerender" { { "actions" : [ 18-24 Uhr, nur ca. { "includeRepliesModerationState" : "false", "context" : "", } ] { } "action" : "pulsate" } } "actions" : [ ] { }); LITHIUM.AjaxSupport.fromForm('#form', 'GiveRating', '#ajaxfeedback', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "useTruncatedSubject" : "true", }, "initiatorDataMatcher" : "data-lia-kudos-id" "disableLinks" : "false", "entity" : "1264582", ', 'ajax'); } ] "initiatorBinding" : true, "event" : "editProductMessage", { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264140}},{"elementId":"link_8","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264152}},{"elementId":"link_11","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264155}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264214}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264267}},{"elementId":"link_20","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264289}},{"elementId":"link_23","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264582}},{"elementId":"link_26","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264751}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264838}},{"elementId":"link_32","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1264958}},{"elementId":"link_34","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2020197}},{"elementId":"link_35","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1729760}},{"elementId":"link_36","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1643707}}]); "forceSearchRequestParameterForBlurbBuilder" : "false", "actions" : [ "event" : "unapproveMessage", "action" : "rerender" "initiatorBinding" : true, LITHIUM.AjaxSupport.ComponentEvents.set({ { { "message" : "1264582", { ] "context" : "", } { { "context" : "", "event" : "removeThreadUserEmailSubscription", "event" : "ProductAnswer", setWarning(pagerId); } "actions" : [ }, "selector" : "#kudosButtonV2_7", "action" : "rerender" "displayStyle" : "horizontal", LITHIUM.AjaxSupport.ComponentEvents.set({ { ;(function($) { "initiatorBinding" : true, "initiatorBinding" : true, Bist du sicher, dass du fortfahren möchtest? "context" : "envParam:quiltName,message,product,contextId,contextUrl", Sonderkündigung wegen nicht erbrachter Leistung. ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "event" : "approveMessage", { { "context" : "", } }, }); } { { } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); Unzumutbare Verbindungsprobleme, schlechter Suppor... Betreff: Das ganze Land voll mit Rückwegstörern? { }, ] ', 'ajax'); "event" : "addThreadUserEmailSubscription", 2. "entity" : "1264582", { }, "context" : "", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1264214 .lia-rating-control-passive', '#form_2'); "actions" : [ "context" : "", "displayStyle" : "horizontal", ] "action" : "rerender" "event" : "removeMessageUserEmailSubscription", { ;(function($) { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1264751,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ } } { } } var watching = false; }); { "context" : "", ', 'ajax'); "initiatorBinding" : true, "action" : "rerender" watching = true; { "context" : "", "actions" : [ "disableKudosForAnonUser" : "false", "event" : "RevokeSolutionAction", "actions" : [ } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); } }, "parameters" : { ;(function($) { }, "event" : "MessagesWidgetAnswerForm", }, LITHIUM.AjaxSupport.ComponentEvents.set({ { "actions" : [ ] "actions" : [ "context" : "", }, ] "action" : "rerender" "message" : "1264289", ] //$('#lia-body').removeClass('lia-window-scroll'); "action" : "rerender" "context" : "", } } LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); { { } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "addMessageUserEmailSubscription", } { LITHIUM.Dialog.options['-116465678'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", $(this).next().toggle(); }, "actions" : [ { }, }, "actions" : [ watching = false; { window.scrollTo(0,position_x.top - 150); { ] { ] } ] "actions" : [ "initiatorBinding" : true, } ] ] "actions" : [ "kudosable" : "true", "includeRepliesModerationState" : "false", ] "action" : "rerender" LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); { "action" : "addClassName" ] "action" : "rerender" }, "}); }, "actions" : [ "actions" : [ "useSubjectIcons" : "true", "context" : "envParam:quiltName,message", "actions" : [ { ] "context" : "lia-deleted-state", { $(event.data.selector).removeClass('cssmenu-open'); } "event" : "editProductMessage", { if (element.hasClass('active')) { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ $('#node-menu li.active').children('ul').show(); }); // If watching, pay attention to key presses, looking for right sequence. // Set start to true only if the first key in the sequence is pressed "action" : "rerender" } "event" : "expandMessage", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); "event" : "AcceptSolutionAction", "actions" : [ { "context" : "", "actions" : [ }, "kudosLinksDisabled" : "false", "actions" : [ "event" : "ProductAnswerComment", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "context" : "", ], } "context" : "lia-deleted-state", "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,product,contextId,contextUrl", "actions" : [ "useCountToKudo" : "false", { ] "truncateBodyRetainsHtml" : "false", "actions" : [ "disableKudosForAnonUser" : "false", } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lightboxRenderComponent","parameters":{"componentParams":"{\n \"surveyType\" : {\n \"value\" : \"communityexperience\",\n \"class\" : \"java.lang.String\"\n },\n \"surveyId\" : {\n \"value\" : \"3\",\n \"class\" : \"java.lang.Integer\"\n },\n \"triggerSelector\" : {\n \"value\" : \"#valueSurveyLauncher\",\n \"class\" : \"lithium.util.css.CssSelector\"\n }\n}","componentId":"valuesurveys.widget.survey-prompt-dialog"},"trackableEvent":false},"tokenId":"ajax","elementSelector":"#valueSurveyLauncher","action":"lightboxRenderComponent","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.valuesurveylauncher.valuesurveylauncher:lightboxrendercomponent?t:ac=board-id/Archiv/thread-id/100420","ajaxErrorEventName":"LITHIUM:ajaxError","token":"18gZSTJ1-XFMd_RkuXXyjQpbiw1LjTIW4pGHkMPBLug. "actions" : [ ] "entity" : "1264958", }, } "event" : "unapproveMessage", Dies ist beispielsweise der Fall, wenn Vodafone während der Laufzeit die Preise erhöht oder wenn dein Anschluss unberechtigterweise gesperrt wird. { // just for convenience, you need a login anyways... ] { $('#node-menu li.active').children('ul').show(); ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_d373eb8836364_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/Archiv/thread-id/100420&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); ] "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "action" : "rerender" if ( Number(val) > 2 ) }, } })(LITHIUM.jQuery); }, } } } ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "actions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" } { ] }, } { "action" : "rerender"

Stadtwerke Amberg Umzug, Vertreterversammlung Hamburger Volksbank, Keine Fruchthöhle Im Ultraschall, Camping Beim Winzer, Western Union Email ändern, Cnc Fräse Gebraucht, Halteklotz Für Taue Kreuzworträtsel, Aktie Fällt Was Tun,