{ } })(LITHIUM.jQuery); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_5","componentSelector":"#lineardisplaymessageviewwrapper_5","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1712859,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "ProductAnswer", { var watching = false; ;(function($) { })(LITHIUM.jQuery); { { "activecastFullscreen" : false, "context" : "envParam:quiltName", "action" : "rerender" "selector" : "#kudosButtonV2_9", "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] } if ( count == neededkeys.length ) { } "event" : "MessagesWidgetAnswerForm", I am going round the twist trying to resolve this problem. "actions" : [ "truncateBody" : "true", } "quiltName" : "ForumMessage", "action" : "rerender" "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] { "revokeMode" : "true", { "actions" : [ { { "event" : "MessagesWidgetAnswerForm", }, }, return false; { "event" : "addThreadUserEmailSubscription", } { "actions" : [ "action" : "rerender" "context" : "", "event" : "approveMessage", { { } "useCountToKudo" : "false", } } } }, "action" : "rerender" "context" : "", ] "initiatorDataMatcher" : "data-lia-message-uid" { "event" : "MessagesWidgetMessageEdit", } ] "parameters" : { "kudosable" : "true", }, return; } } "disallowZeroCount" : "false", { "disableKudosForAnonUser" : "false", "context" : "", { ] Bank of Ireland app not working. "action" : "rerender" "action" : "pulsate" "action" : "rerender" "action" : "rerender" "message" : "1712912", "initiatorDataMatcher" : "data-lia-kudos-id" }, { "showCountOnly" : "false", }, }, { "actions" : [ "useTruncatedSubject" : "true", var expireDate = new Date(); "actions" : [ }, LITHIUM.Dialog.options['-117237962'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } { "context" : "", }, { "action" : "rerender" setCookie: function(cookieName, cookieValue) { "actions" : [ } Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" { "event" : "removeMessageUserEmailSubscription", } } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_3","componentSelector":"#lineardisplaymessageviewwrapper_3","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1712320,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "context" : "", ] if (val.trim() == "") "actions" : [ "context" : "envParam:quiltName,message", ] } $('.community-menu').removeClass('active') { "actions" : [ "action" : "rerender" ] if ( neededkeys[count] == key ) { { "actions" : [ var handleClose = function(event) { { LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); { clearWarning(pagerId); "actions" : [ "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); "action" : "rerender" "componentId" : "kudos.widget.button", { "action" : "pulsate" "includeRepliesModerationState" : "false", } }, "action" : "rerender" } "actions" : [ "useSubjectIcons" : "true", setCookie: function(cookieName, cookieValue) { "eventActions" : [ "truncateBody" : "true", }); { "displaySubject" : "true", }, }, "linkDisabled" : "false" }, "action" : "rerender" "actions" : [ { "action" : "rerender" ] return false; "event" : "editProductMessage", "event" : "ProductAnswer", "linkDisabled" : "false" { element.siblings('li').children('ul').slideUp(); { "context" : "", LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); }, "event" : "approveMessage", }, "event" : "MessagesWidgetCommentForm", function doChecks(pagerId, val) { "entity" : "1712867", { "actions" : [ } { "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "context" : "envParam:entity", window.location = "https://forum.vodafone.de/t5/MeinVodafone-MeinKabel-E-Mail/MeinVodafone-app-Anmeldung-nicht-m%C3%B6glich/td-p/1712192" + "/page/" + val; "useSubjectIcons" : "true", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"8N6DknJERL3xBm-AFHEnkmrI04L4ELd3BmgjMGVirR8. { ] }, "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } $('#vodafone-community-header .lia-button-wrapper-searchForm-action').toggleClass('active'); Download the free My Vodafone app. "truncateBody" : "true", "action" : "rerender" }, "context" : "", ] } "kudosLinksDisabled" : "false", { "action" : "rerender" { { } "disableLinks" : "false", .attr('aria-hidden','false') ] }, "displayStyle" : "horizontal", } "action" : "rerender" // Set start to true only if the first key in the sequence is pressed "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_2","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"YPDIlQbQjx8z3isTzSZ6WX4ScFF0_2JpPiFvqD3Dry0. "event" : "MessagesWidgetEditCommentForm", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" { } { "actions" : [ { }, "disableKudosForAnonUser" : "false", Bist du sicher, dass du fortfahren möchtest? "event" : "MessagesWidgetCommentForm", } "event" : "deleteMessage", "initiatorBinding" : true, { "forceSearchRequestParameterForBlurbBuilder" : "false", } { "context" : "", "context" : "", }, "selector" : "#messageview_1", }, } { "action" : "pulsate" "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "action" : "rerender" Mein Wunsch wäre es gewesen, von einem anderen Anbieter weg zu kommen und Vodafone Kunde zu werden. "event" : "MessagesWidgetMessageEdit", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "}); "actions" : [ "linkDisabled" : "false" "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "addMessageUserEmailSubscription", { "context" : "", "useSimpleView" : "false", { ] "event" : "RevokeSolutionAction", "action" : "rerender" "actions" : [ { "action" : "rerender" LITHIUM.StarRating('#any_0_0', true, 2, 'LITHIUM:starRating'); function disableInput(pagerId) { window.scrollTo(0,position_x.top - 150); "actions" : [ { "actions" : [ "showCountOnly" : "false", }); }, { "}); }, { { ], ] ;(function($) { "useTruncatedSubject" : "true", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "kudosLinksDisabled" : "false", "initiatorBinding" : true, }, Bist du sicher, dass du fortfahren möchtest? element.removeClass('active'); "event" : "addThreadUserEmailSubscription", "actions" : [ } "context" : "envParam:quiltName,expandedQuiltName", "action" : "rerender" ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_38","feedbackSelector":".InfoMessage"}); element.siblings('li').children('ul').slideUp(); "actions" : [ "selector" : "#kudosButtonV2_1", } { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); ] { }, }, ] LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; ] "actions" : [ }, "context" : "envParam:feedbackData", }, lithstudio: [], }); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useSimpleView" : "false", "actions" : [ }, "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "displayStyle" : "horizontal", } } "context" : "envParam:quiltName,message", }, { "action" : "pulsate" }, { { "dialogContentCssClass" : "lia-panel-dialog-content", "action" : "rerender" ] } "action" : "rerender" "event" : "ProductAnswerComment", LITHIUM.StarRating('#any_7', false, 1, 'LITHIUM:starRating'); "showCountOnly" : "false", } { "action" : "rerender" "event" : "approveMessage", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_6","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_6","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pyDDJTHg7X5rV2Joy2uPDB2etgIH-yB86IUx-96zHCY. }, "actions" : [ "context" : "envParam:feedbackData", "initiatorDataMatcher" : "data-lia-message-uid" }); { { > 0) ) }, "revokeMode" : "true", "event" : "unapproveMessage", { }, } "context" : "envParam:feedbackData", }, ] "context" : "envParam:quiltName,message", }, { { // --> "actions" : [ } "event" : "ProductAnswer", Bist du sicher, dass du fortfahren möchtest? "event" : "QuickReply", { } ] "action" : "rerender" "actions" : [ sessionStorage.setItem("is_scroll", option); { "displaySubject" : "true", "actions" : [ "}); "action" : "rerender" "parameters" : { "useSimpleView" : "false", { "action" : "rerender" "actions" : [ "context" : "envParam:entity", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "ProductAnswerComment", Vodafone Idea Limited is an Aditya Birla Group and Vodafone Group partnership. { LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234203}); "revokeMode" : "true", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "context" : "", $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ }, }, { "context" : "envParam:entity", { "action" : "rerender" }, ] }, "; "event" : "unapproveMessage", LITHIUM.AjaxSupport.fromForm('#form_8', 'GiveRating', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "action" : "rerender" Execute whatever should happen when entering the right sequence } "disableKudosForAnonUser" : "false", { }, "action" : "pulsate" "event" : "addMessageUserEmailSubscription", count = 0; "context" : "", }, }, // We made it! "initiatorBinding" : true, Wenn Du Dich per WLAN mit Deinem Handy-Nummer in die MeinVodafone-App einloggst, zählt das nicht als Login. }, ] }, { LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "pulsate" } ', 'ajax'); { "event" : "MessagesWidgetCommentForm", "actions" : [ "action" : "addClassName" }); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_43","feedbackSelector":".InfoMessage"}); "action" : "pulsate" "revokeMode" : "true", "action" : "rerender" "context" : "envParam:selectedMessage", ] "action" : "pulsate" } $('#vodafone-community-header .lia-search-input-wrapper').fadeToggle() "event" : "markAsSpamWithoutRedirect", { "action" : "rerender" "action" : "rerender" { LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_6582b1f268ed8","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_6582b1f268ed8_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/9001/thread-id/42105&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"GPARDGFCtkJZSS4_SD7azoAN3-hxKRQHL8dZEeJoARg. ] "initiatorDataMatcher" : "data-lia-message-uid" { "action" : "rerender" { resetMenu(); "context" : "envParam:quiltName,message", { ] ] { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_5","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_5","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"A6DPzdenpqNRNY93W97VM6KZDvp-9ZaXDbhT8eChQV8. { ] { "action" : "rerender" }, "event" : "kudoEntity", "event" : "removeThreadUserEmailSubscription", ] { "actions" : [ "event" : "editProductMessage", "initiatorBinding" : true, { ] "truncateBody" : "true", } "action" : "rerender" { "}); } }, "action" : "pulsate" } "context" : "", "actions" : [ return false; "action" : "rerender" { } ] return; { ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", }, }, "selector" : "#messageview_6", LITHIUM.Dialog.options['-1138495498'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { } ] "useTruncatedSubject" : "true", "event" : "approveMessage", "action" : "rerender" "context" : "envParam:entity", "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/9001/thread-id/42105","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EQecH4AIlcRvGnlcGziyt8Fbg8xCbhdPwrveor0MvIQ. ] "componentId" : "kudos.widget.button", "event" : "kudoEntity", "actions" : [ Using My Vodafone. "actions" : [ "actions" : [ } "context" : "", "event" : "MessagesWidgetAnswerForm", "componentId" : "kudos.widget.button", "actions" : [ "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "initiatorBinding" : true, "event" : "ProductAnswer", ] "action" : "rerender" "actions" : [ } { "actions" : [ { "event" : "AcceptSolutionAction", { { }, ] { "event" : "MessagesWidgetAnswerForm", { "actions" : [ LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "actions" : [ { "action" : "rerender" "context" : "", }, ;(function($) { var keycodes = { }); { } }); "action" : "pulsate" { }, { "actions" : [ { } LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "message" : "1712867", Set up your smart devices and manage your price plans all in one place with the Vodafone Smart App (also known as the V by Vodafone app). } "event" : "MessagesWidgetCommentForm", }); "action" : "rerender" "context" : "", { }, "context" : "envParam:feedbackData", { "event" : "QuickReply", "event" : "ProductMessageEdit", "action" : "pulsate" ] "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", }, }, ] "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", "disableLinks" : "false", "displayStyle" : "horizontal", { "eventActions" : [ "displayStyle" : "horizontal", }, } } "actions" : [ { "actions" : [ "useSubjectIcons" : "true", } }, { }, }, } { "action" : "rerender" { "entity" : "1712859", "event" : "unapproveMessage", "event" : "ProductAnswerComment", var ctaHTML = '. "context" : "envParam:quiltName,message", "selector" : "#kudosButtonV2_8", { { "context" : "", ] }, }, { "action" : "rerender" } "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "pulsate" }, "event" : "MessagesWidgetEditCommentForm", LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "actions" : [ } "context" : "", var count = 0; "action" : "rerender" } ] "action" : "rerender" "action" : "addClassName" { { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "selector" : "#kudosButtonV2_9", ] "parameters" : { ] "action" : "rerender" }, }, } "context" : "envParam:entity", "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "action" : "rerender" document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "kudosLinksDisabled" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "truncateBodyRetainsHtml" : "false", { "context" : "", "action" : "rerender" { "action" : "rerender" "actions" : [ { LITHIUM.Loader.runJsAttached(); "useCountToKudo" : "false", "context" : "envParam:selectedMessage", ] { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_34","feedbackSelector":".InfoMessage"}); //if(height > 430) { { { "context" : "", { "action" : "rerender" ] } } Go to store locator. }, } window.location.replace('/t5/user/userloginpage'); ] "truncateBody" : "true", "context" : "", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "action" : "rerender" "forceSearchRequestParameterForBlurbBuilder" : "false", ] { { "actions" : [ } "context" : "envParam:feedbackData", } "actions" : [ "action" : "rerender" }, "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:quiltName", }); { "useSubjectIcons" : "true", "action" : "rerender" "componentId" : "forums.widget.message-view", "action" : "addClassName" "event" : "addThreadUserEmailSubscription", { } ] "action" : "rerender" "; } if ( key == neededkeys[0] ) { "action" : "pulsate" "showCountOnly" : "false", "disableKudosForAnonUser" : "false", } "event" : "MessagesWidgetEditCommentForm", } } "useCountToKudo" : "false", "message" : "1712427", ] "disallowZeroCount" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_52","feedbackSelector":".InfoMessage"}); } "actions" : [ "actions" : [ "event" : "ProductAnswer", ] { ] "event" : "ProductAnswer", "actions" : [ "showCountOnly" : "false", "}); } "event" : "markAsSpamWithoutRedirect", } LITHIUM.Dialog({ count++; LITHIUM.AjaxSupport.ComponentEvents.set({ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { ] "includeRepliesModerationState" : "false", "action" : "rerender" "linkDisabled" : "false" "context" : "", "context" : "", 60.32 Mb/s Download Speed. "actions" : [ if ( !watching ) { ] ] } } }, "actions" : [ "message" : "1712427", { } "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_7 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "action" : "pulsate" "quiltName" : "ForumMessage", ] { }); } }, ] Vodafone invests €20 million to advance digital skills and education across 13 European countries and Turkey. "selector" : "#messageview_0", "initiatorDataMatcher" : "data-lia-kudos-id" lithadmin: [] "event" : "approveMessage", "event" : "RevokeSolutionAction", { ] "context" : "envParam:quiltName", "context" : "", "actions" : [ "parameters" : { } { "event" : "removeMessageUserEmailSubscription", }, "actions" : [ { "event" : "ProductAnswer", "action" : "rerender" ] } "context" : "", ] "showCountOnly" : "false", "action" : "rerender" } ] return false; "entity" : "1712933", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); ], "buttonDialogCloseAlt" : "Schließen", expireDate.setDate(expireDate.getDate() + 365*10); "context" : "", "action" : "rerender" "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); "action" : "rerender" "disableLabelLinks" : "false", "action" : "rerender" "actions" : [ ] "triggerSelector" : ".lia-panel-dialog-trigger-event-click", // Set start to true only if the first key in the sequence is pressed }); "showCountOnly" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "eventActions" : [ }, "context" : "envParam:entity",

Höchster Bildungsabschluss österreich, Cnc Steuerung Set, Imprägniertes Holz Hornbach, 7 Zimmer Wohnung Bremen, Geranien Gehen Ein, Vodafone Außerordentliche Kündigung Wegen Nicht Erbrachter Leistung, Allah Sagt Wenn Du Jemanden Mehr Als Mich Liebst, Schule Früher Stundenplan, Wie Lange Sollte Man Nach Einem Stent Nicht Arbeiten,