"context" : "", } }, { { ] }, ;(function($){ '; "context" : "", } expireDate.setDate(expireDate.getDate() + 365*10); }, } { "context" : "envParam:quiltName", ] }, ] LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); $('.menu-container').on('click','.community-user-menu-btn:not(.active)', {'selector' : '.css-user-menu'}, handleOpen); }, }, ] "event" : "AcceptSolutionAction", ] "actions" : [ { "context" : "envParam:quiltName,expandedQuiltName", $(document).ready(function(){ } "action" : "rerender" ] "actions" : [ "action" : "pulsate" { "actions" : [ "actions" : [ "actions" : [ { { }); { "context" : "", "event" : "removeThreadUserEmailSubscription", return; { "action" : "rerender" { }, "accessibility" : false, }, "event" : "removeThreadUserEmailSubscription", } LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "pulsate" { } "useTruncatedSubject" : "true", } "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetMessageEdit", "truncateBodyRetainsHtml" : "false", "event" : "kudoEntity", "actions" : [ ] }); }, "message" : "1712192", })(LITHIUM.jQuery); "action" : "pulsate" "event" : "kudoEntity", "event" : "MessagesWidgetEditAnswerForm", { "action" : "rerender" Bist du sicher, dass du fortfahren möchtest? { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", if ( count == neededkeys.length ) { "event" : "removeThreadUserEmailSubscription", } } "event" : "MessagesWidgetEditAction", "event" : "AcceptSolutionAction", "context" : "", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("disabled","1"); "event" : "MessagesWidgetEditCommentForm", ] }, } "event" : "MessagesWidgetEditAnswerForm", }, "useCountToKudo" : "false", } "actions" : [ { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBody" : "true", "showCountOnly" : "false", "action" : "rerender" "action" : "addClassName" ] LITHIUM.InputEditForm("form_2", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "disableLabelLinks" : "false", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9f4vVDUToD8Y2HAjnY0OnTwUPHPg0nCnT1ATxv3znzw. { }, "initiatorBinding" : true, ] "actions" : [ "action" : "rerender" "parameters" : { "forceSearchRequestParameterForBlurbBuilder" : "false", { "event" : "QuickReply", "action" : "rerender" { "action" : "rerender" "actions" : [ })(LITHIUM.jQuery); } "action" : "rerender" { "; } } ] "event" : "unapproveMessage", ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "context" : "", "actions" : [ { ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { } "action" : "rerender" "action" : "addClassName" "event" : "ProductAnswerComment", }, "event" : "addThreadUserEmailSubscription", "event" : "QuickReply", } "context" : "envParam:quiltName", { { }, "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", clearWarning(pagerId); })(LITHIUM.jQuery); // Pull in global jQuery reference $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "context" : "envParam:quiltName,message,product,contextId,contextUrl", } "context" : "envParam:quiltName,product,contextId,contextUrl", { "actions" : [ ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_8","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_8","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"9f4vVDUToD8Y2HAjnY0OnTwUPHPg0nCnT1ATxv3znzw. "actions" : [ ], } praxistipps.chip.de › Internet. "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", // Reset the conditions so that someone can do it all again. LITHIUM.InputEditForm("form_6", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. return; LITHIUM.AjaxSupport.fromLink('#kudoEntity_6', 'kudoEntity', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {}, 'J5B9NY5SOPsxu0Gp4YZiUOGtezcYKFPBxdkgd4Fd2UU. ] ] "actions" : [ "disableKudosForAnonUser" : "false", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "action" : "rerender" "actions" : [ "linkDisabled" : "false" }, } "componentId" : "kudos.widget.button", G_sachin_dabral_RgIV. "event" : "MessagesWidgetEditCommentForm", } ] "actions" : [ ] "event" : "addMessageUserEmailSubscription", { } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, LITHIUM.Dialog.options['-16529610'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "disallowZeroCount" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ }, "parameters" : { }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1714713,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "action" : "rerender" } ], "context" : "envParam:quiltName,expandedQuiltName", } }, ] LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); }, "actions" : [ } "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1712867,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] "event" : "removeMessageUserEmailSubscription", { "actions" : [ } "actions" : [ }, }; "action" : "rerender" "action" : "rerender" { { }, { }); "action" : "rerender" "context" : "", { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "event" : "unapproveMessage", Hallo, habe seit heute Nachmittag das Problem das ich mich über die App nicht einloggen kann. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1712427,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); } { LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:entity", { }, }, ] ] var count = 0; "actions" : [ "event" : "removeMessageUserEmailSubscription", ', 'ajax'); "parameters" : { o.innerHTML = "Page number can\'t exceed 3. "actions" : [ }, "context" : "", LITHIUM.AjaxSupport.ComponentEvents.set({ "disableLinks" : "false", } } "context" : "", ] "messageViewOptions" : "1111110111111111111110111110100101001101" Bist du sicher, dass du fortfahren möchtest? ] { "truncateBody" : "true", }, "displayStyle" : "horizontal", "context" : "envParam:quiltName", ] { ], } "context" : "", "actions" : [ LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "context" : "lia-deleted-state", { ] } "useCountToKudo" : "false", ] Natürlich kannst auch Du anderen behilflich sein, wenn Du einen guten Lösungsvorschlag für ein Problem hast und diesen weiter unten mitteilst. "useSubjectIcons" : "true", //if(height > 430) { { }, "actions" : [ ] } //$('#community-menu-toggle').removeClass('active') "componentId" : "forums.widget.message-view", "action" : "rerender" }, }, "truncateBody" : "true", "displaySubject" : "true", }, "action" : "rerender" ] { "}); ] "actions" : [ var handleOpen = function(event) { }, "event" : "MessagesWidgetEditCommentForm", ] // Oops. { { "actions" : [ } "useCountToKudo" : "false", }, ] "context" : "", } { { "}); "action" : "rerender" "event" : "unapproveMessage", "actions" : [ "event" : "MessagesWidgetMessageEdit", }, "useCountToKudo" : "false", { ","loaderSelector":"#lineardisplaymessageviewwrapper_8 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ { var key = e.keyCode; "context" : "envParam:quiltName", ], { "event" : "kudoEntity", "action" : "rerender" "event" : "ProductAnswerComment", "useTruncatedSubject" : "true", { } { }); { "action" : "rerender" "context" : "envParam:selectedMessage", { $('#vodafone-community-header').toggle(); "actions" : [ setWarning(pagerId); "context" : "envParam:selectedMessage", ] } "parameters" : { "action" : "rerender" ] So soll es nämlich sein - egal, ob CallYa oder Vertrag. ) { ] "actions" : [ lithstudio: [], ] }, { LITHIUM.Loader.runJsAttached(); { { ] { "forceSearchRequestParameterForBlurbBuilder" : "false", document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "event" : "addThreadUserEmailSubscription", }); var ctaHTML = ''; "initiatorDataMatcher" : "data-lia-message-uid" "disallowZeroCount" : "false", ] } }, $('div[class*="-menu-btn"]').removeClass('active'); }, }, ] }, { "initiatorDataMatcher" : "data-lia-message-uid" "event" : "RevokeSolutionAction", ] "context" : "", ', 'ajax'); "actions" : [ "context" : "", "showCountOnly" : "false", function createStorage(option){ "actions" : [ } Shop Shop Upgrade; Specials. // Set start to true only if the first key in the sequence is pressed "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.MessageBodyDisplay('#bodyDisplay_6', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { "event" : "markAsSpamWithoutRedirect", "actions" : [ { "actions" : [ "event" : "AcceptSolutionAction", "event" : "MessagesWidgetAnswerForm", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_9","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_9","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"m19lH700ZDBrtLrgW5UtW0jO7XlRlIqrFJDTzPYj-OQ. "disableLabelLinks" : "false", } { { "useSimpleView" : "false", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_8","menuItemsSelector":".lia-menu-dropdown-items"}}); { return false; ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "revokeMode" : "true", } { "event" : "approveMessage", } // Reset the conditions so that someone can do it all again. "truncateBody" : "true", "context" : "", }, function processPageInputBlur(pagerId, val) document.getElementById("custom_board_pagination_no" + pagerId).setAttribute("class","custom_board_pagination_no"); "actions" : [ ] "event" : "unapproveMessage", var keycodes = { { "context" : "envParam:selectedMessage", ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] "useCountToKudo" : "false", "event" : "MessagesWidgetEditCommentForm", { ] // We're good so far. "event" : "removeThreadUserEmailSubscription", }, { //$('#lia-body').addClass('lia-window-scroll'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_27","feedbackSelector":".InfoMessage"}); { "action" : "rerender" } { "action" : "rerender" LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); .attr('aria-expanded','true') }, { "context" : "envParam:selectedMessage", "action" : "pulsate" LITHIUM.StarRating('#any_0_9', true, 2, 'LITHIUM:starRating'); ] "forceSearchRequestParameterForBlurbBuilder" : "false", "message" : "1712859", The Second Method is to download the Vodafone Play app by using the Memu Play computer. { } }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); Vodafone is a leader in technology communications through mobile, fixed, broadband and TV. }, "context" : "envParam:quiltName", "action" : "rerender" } } "action" : "rerender" { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "rerender" "event" : "MessagesWidgetEditAction", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "action" : "addClassName" ] "action" : "rerender" }, "showCountOnly" : "false", "context" : "envParam:quiltName,product,contextId,contextUrl", { { "event" : "editProductMessage", } { "event" : "ProductMessageEdit", "context" : "envParam:feedbackData", "event" : "addThreadUserEmailSubscription", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/7001/thread-id/81966","ajaxErrorEventName":"LITHIUM:ajaxError","token":"qhVtK7u_lOIBbkKNnowOCkKQNatBWsS-smY5LxwomnM. } { }, "selector" : "#kudosButtonV2_3", "disableLabelLinks" : "false", { "actions" : [ "event" : "deleteMessage", "actions" : [ "eventActions" : [ "actions" : [ "actions" : [ { { }, "action" : "rerender" "context" : "envParam:quiltName,message", "action" : "rerender" "event" : "addMessageUserEmailSubscription", }, "kudosLinksDisabled" : "false", } $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); { "truncateBody" : "true", { }, { }, "closeEvent" : "LITHIUM:lightboxCloseEvent", "parameters" : { "context" : "envParam:quiltName", "action" : "rerender" "action" : "addClassName" { ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "selector" : "#kudosButtonV2_0", } "selector" : "#kudosButtonV2_9", "componentId" : "kudos.widget.button", "context" : "envParam:quiltName,expandedQuiltName", "displaySubject" : "true", "event" : "ProductAnswer", "context" : "envParam:quiltName", "event" : "approveMessage", "event" : "ProductMessageEdit", "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1712247,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "event" : "addThreadUserEmailSubscription", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "entity" : "1712912", { "actions" : [ ] "event" : "kudoEntity", { "action" : "rerender" "; "componentId" : "forums.widget.message-view", ] ] "actions" : [ "event" : "approveMessage", "kudosLinksDisabled" : "false", } { "action" : "rerender" { "showCountOnly" : "false", { { { ] { ] "context" : "envParam:quiltName,expandedQuiltName", }, "useSubjectIcons" : "true", { "context" : "", } }, } "actions" : [ "event" : "expandMessage", { { "action" : "rerender" lithadmin: [] { { }, { ] { ] "accessibility" : false, "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_33","feedbackSelector":".InfoMessage"}); { Bist du sicher, dass du fortfahren möchtest? { ] "revokeMode" : "true", "context" : "envParam:selectedMessage", }, } "event" : "removeThreadUserEmailSubscription", "action" : "pulsate" { LITHIUM.AjaxSupport.fromForm('#form_9', 'GiveRating', '#ajaxfeedback_9', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); ] "action" : "rerender" { ] "quiltName" : "ForumMessage", "context" : "lia-deleted-state", "useCountToKudo" : "false", ] ] ] ] { LITHIUM.AjaxSupport.fromLink('#kudoEntity_4', 'kudoEntity', '#ajaxfeedback_4', 'LITHIUM:ajaxError', {}, 'beqHk6TyIKsVkNUNdyTIXOCr9-r0UfgfFXwVd5XmZ6k. LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); } ] }, } {