"disableLabelLinks" : "false", LITHIUM.Loader.runJsAttached(); Schnell upgraden und 3 Monate zum bisherigen Preis sichern: Mehr Leistung für gleiches Geld! "event" : "addThreadUserEmailSubscription", "event" : "MessagesWidgetEditAction", "action" : "rerender" "event" : "MessagesWidgetCommentForm", { ] { } "useSimpleView" : "false", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "defaultAriaLabel" : "", "kudosable" : "true", "actions" : [ "action" : "rerender" "displaySubject" : "true", }, Rechnung und Kosten ... Hardware, z.B. "actions" : [ { ] { { LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1405984,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "context" : "", }, { }, element.removeClass('active'); watching = false; { "context" : "", { } { "context" : "", ] "action" : "rerender" { $(document).ready(function(){ "action" : "pulsate" }, "actions" : [ }, LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", gesetzl. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" }, ] } } count = 0; } }, "action" : "rerender" "dialogContentCssClass" : "lia-panel-dialog-content", LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234366}); }, }); }, }, } ] "useSubjectIcons" : "true", }, "actions" : [ ], } { "dialogKey" : "dialogKey" } ;(function($) { "}); ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); LITHIUM.Dialog.options['-1356089622'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "event" : "MessagesWidgetMessageEdit", "disableLinks" : "false", { "context" : "", Alle Kudogeber anzeigen. ], { "actions" : [ "context" : "", ] }, } } "actions" : [ ] ] Das Verbraucherportal für … LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); LITHIUM.ValueSurveyLauncher({"detectPopUpCSS":".lia-dialog-open","dialogLinkSelector":"#valueSurveyLauncher","launchDelay":234366}); ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { })(LITHIUM.jQuery); // Pull in global jQuery reference "disableLinks" : "false", ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "ProductAnswer", if ( neededkeys[count] == key ) { } { "action" : "rerender" }, "event" : "markAsSpamWithoutRedirect", { "showCountOnly" : "false", ] { "actions" : [ }, "selector" : "#kudosButtonV2_0", { } { ] ] ] var clickHandler = function(event) { "action" : "rerender" }, }, { ] } "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "event" : "QuickReply", } ] "event" : "ProductAnswer", "initiatorBinding" : true, LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); } "actions" : [ "includeRepliesModerationState" : "false", { LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchform_38c8accaab9bf9","nodesModel":{"Endgeraete|category":{"title":"Kategorie-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"user|user":{"title":"Benutzer","inputSelector":".lia-search-input-user"},"vodafonede|community":{"title":"Community-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"},"ArchivKIP|forum-board":{"title":"Board-Suche: Archiv_Internet-Geräte","inputSelector":".lia-search-input-message"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_38c8accaab9bf9_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); "entity" : "1405966", "actions" : [ ] "action" : "rerender" Ist halt mal wieder Typisch Deutschland, in manch anderen Ländern gibts längst auch feste IP´s für Privatkunden. Bist du sicher, dass du fortfahren möchtest? } Aktualisiere bitte Deinen Browser oder lad Dir einen neuen Browser herunter. "revokeMode" : "true", "includeRepliesModerationState" : "false", ] "useSubjectIcons" : "true", { lithstudio: [], "event" : "editProductMessage", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1405979,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { } } "initiatorDataMatcher" : "data-lia-kudos-id" }, "initiatorBinding" : true, "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "action" : "rerender" { "showCountOnly" : "false", LITHIUM.AjaxSupport.fromForm('#form_2', 'GiveRating', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "selector" : "#messageview_1", }, "event" : "RevokeSolutionAction", "event" : "removeThreadUserEmailSubscription", { "actions" : [ "event" : "addMessageUserEmailSubscription", "action" : "rerender" "action" : "pulsate" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:selectedMessage", "event" : "RevokeSolutionAction", "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_16","feedbackSelector":".InfoMessage"}); "event" : "QuickReply", "actions" : [ "}); "selector" : "#messageview_1", "actions" : [ Execute whatever should happen when entering the right sequence ] "selector" : "#kudosButtonV2", "action" : "rerender" "}); LITHIUM.Dialog.options['606259794'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "includeRepliesModerationState" : "false", } { "actions" : [ ] "action" : "rerender" "actions" : [ }, "event" : "editProductMessage", "context" : "", $('#node-menu li.has-sub>a').on('click', function(){ LITHIUM.StarRating('#any_0_3', true, 2, 'LITHIUM:starRating'); })(LITHIUM.jQuery); "action" : "rerender" }); "useSubjectIcons" : "true", } { "actions" : [ $(document).keydown(function(e) { ], "disallowZeroCount" : "false", "actions" : [ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); count = 0; { var count = 0; { "actions" : [ { "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; "context" : "envParam:quiltName,message", })(LITHIUM.jQuery); "revokeMode" : "true", ] { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ], $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ { } }, }); { ;(function($) { { LITHIUM.StarRating('#any_4', false, 1, 'LITHIUM:starRating'); { { } "event" : "ProductAnswer", Wenn Sie sich für einen der Vodafone-Tarife entscheiden, dann surfen Sie mit bis zu 1000 Mbit/s im Download. }, "actions" : [ { }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); { // We're good so far. "action" : "rerender" "action" : "rerender" /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "useSimpleView" : "false", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "componentId" : "forums.widget.message-view", "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, if ( count == neededkeys.length ) { }); }, event.returnValue = false; "action" : "rerender" "action" : "rerender" { ] ;(function($) { "useSubjectIcons" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/48197","ajaxErrorEventName":"LITHIUM:ajaxError","token":"J_dP6s3wDmSF5AHaVPzQmaIYMvGeqiV0Wkp22aY_NA0. "context" : "envParam:quiltName,expandedQuiltName", "context" : "", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "context" : "", // console.log('watching: ' + key); } } } "action" : "rerender" var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); "useTruncatedSubject" : "true", var topicIdCustomAnnouncement = clickedDomElement.data("message-id"); { "context" : "", }, ', 'ajax'); "actions" : [ }, // If watching, pay attention to key presses, looking for right sequence. "action" : "rerender" ] "showCountOnly" : "false", "event" : "kudoEntity", "disallowZeroCount" : "false", "action" : "rerender" "linkDisabled" : "false" { "selector" : "#messageview_3", "event" : "MessagesWidgetAnswerForm", "initiatorBinding" : true, "actions" : [ "event" : "deleteMessage", lithstudio: [], "disableLabelLinks" : "false", } { } } }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "actions" : [ "actions" : [ "}); { { //}); "context" : "", "linkDisabled" : "false" "actions" : [ }, "actions" : [ ] "event" : "AcceptSolutionAction", "event" : "MessagesWidgetEditCommentForm", "actions" : [ } }; { "message" : "1407071", { }, } { }, "actions" : [ ] "initiatorBinding" : true, "event" : "ProductMessageEdit", $(document).ready(function(){ watching = false; { "context" : "envParam:quiltName", } } ] { "includeRepliesModerationState" : "false", }, "}); "event" : "deleteMessage", "event" : "AcceptSolutionAction", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } "includeRepliesModerationState" : "false", ] { "context" : "lia-deleted-state", "kudosLinksDisabled" : "false", "event" : "unapproveMessage", "context" : "envParam:quiltName", { "context" : "envParam:quiltName,expandedQuiltName", LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-1405979 .lia-rating-control-passive', '#form_0'); watching = false; var notifCount = 0; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ "useCountToKudo" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", //var height = $(window).scrollTop(); "context" : "", ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { { Vodafone Business Internet für Unternehmen Ist im eigenen Büro bzw. $('#vodafone-community-header .lia-search-input-wrapper').hide(); /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ }, { "useCountToKudo" : "false", "triggerSelector" : ".lia-panel-dialog-trigger-event-click", "action" : "rerender" "context" : "", }, "action" : "pulsate" element.children('ul').slideDown(); }, "action" : "rerender" var count = 0; Nun benötigen wir, zum Zwecke einiger Kameras, eine feste IP-Adresse. "selector" : "#messageview_0", ] "actions" : [ "action" : "rerender" "context" : "envParam:quiltName", "}); "actions" : [ "context" : "", { "truncateBodyRetainsHtml" : "false", "action" : "rerender" "event" : "ProductMessageEdit", }); },